PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10005438m
Common NameCARUB_v10005438mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 283aa    MW: 32355.6 Da    PI: 8.4191
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10005438mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding543.9e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l+ ++k +G g+W++ +r  g+ R++k+c++rw +yl
  Carubv10005438m 14 KGAWTKEEDDKLISYIKAHGEGCWRSLPRSAGLQRCGKSCRLRWINYL 61
                     79********************************************97 PP

2Myb_DNA-binding551.9e-1767111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg++T +Ed+l+++++ +lG++ W++Ia +++ gRt++++k++w+++
  Carubv10005438m  67 RGNFTLDEDDLIIKLHSLLGNK-WSLIATRLP-GRTDNEIKNYWNTH 111
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.6E-24564IPR009057Homeodomain-like
PROSITE profilePS5129416.89961IPR017930Myb domain
SuperFamilySSF466892.4E-2913108IPR009057Homeodomain-like
SMARTSM007174.1E-131363IPR001005SANT/Myb domain
PfamPF002492.9E-151461IPR001005SANT/Myb domain
CDDcd001678.52E-101661No hitNo description
PROSITE profilePS5129427.67562116IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.9E-2765116IPR009057Homeodomain-like
SMARTSM007179.2E-1766114IPR001005SANT/Myb domain
PfamPF002495.1E-1667111IPR001005SANT/Myb domain
CDDcd001671.12E-1069112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 283 aa     Download sequence    Send to blast
MGRSPCCEKD HTNKGAWTKE EDDKLISYIK AHGEGCWRSL PRSAGLQRCG KSCRLRWINY  60
LRPDLKRGNF TLDEDDLIIK LHSLLGNKWS LIATRLPGRT DNEIKNYWNT HVKRKLLRKG  120
IDPATHRPIN ETKAPQDSSE SSKTEDPLVK ILSFGPQLEK KESFEDERAH KGVICKKDRV  180
EYSYSAFEGR CLDLNLELKI SPPWQDKLHD ETSMRFRREK HMCTSCRFGF GNDKECSCNS  240
AKCQTEDSSS SSYSSSDISS SIAYDFLGLN TRVLDFSSLE MK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-28141167108B-MYB
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5196120.0AY519612.1 Arabidopsis thaliana MYB transcription factor (At4g34990) mRNA, complete cds.
GenBankBT0249070.0BT024907.1 Arabidopsis thaliana At4g34990 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006284274.10.0hypothetical protein CARUB_v10005438mg
SwissprotO496081e-166MYB32_ARATH; Transcription factor MYB32
TrEMBLR0F5U80.0R0F5U8_9BRAS; Uncharacterized protein
STRINGscaffold_700628.11e-166(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G34990.11e-165myb domain protein 32